SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20808643|ref|NP_623814.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20808643|ref|NP_623814.1|
Domain Number 1 Region: 81-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-26
Family Translational machinery components 0.00016
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.56e-21
Family Ribosomal S5 protein, N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20808643|ref|NP_623814.1|
Sequence length 167
Comment 30S ribosomal protein S5 [Thermoanaerobacter tengcongensis MB4]
Sequence
MARVDWTKLNLKERVVSINRVSKVVKGGKNFRFSVTVVVGDPDKGYVGVGRGKAAEIPDA
IRKAIEDAKKHLIKVPVVGTTIPHEVIGEFGAGKVLLKPAREGTGVIAGGPVRAVLESAG
IRDVLSKSLGSSNATNMVYATIEGLKRLKTAEEVARLRGIPVHQLFE
Download sequence
Identical sequences A0A0F5PKP7 Q8R7X1 U5CSA2
gi|20808643|ref|NP_623814.1| WP_011026321.1.13259 WP_011026321.1.70758 WP_011026321.1.99938 273068.TTE2274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]