SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20808725|ref|NP_623896.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|20808725|ref|NP_623896.1|
Domain Number - Region: 5-57
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 0.0394
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20808725|ref|NP_623896.1|
Sequence length 67
Comment hypothetical protein TTE2361 [Thermoanaerobacter tengcongensis MB4]
Sequence
MLPKNAKKEVLDFIEYLIQKRMRIVKELFETTKETKQRLEELGYTEVSISKFVEGIRDNS
KKVPTNN
Download sequence
Identical sequences Q8R7P2
273068.TTE2361 WP_011026400.1.99938 gi|20808725|ref|NP_623896.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]