SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20808811|ref|NP_623982.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20808811|ref|NP_623982.1|
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.74e-35
Family Tetrapyrrole methylase 0.0057
Further Details:      
 
Domain Number 2 Region: 370-468
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 1.03e-25
Family MazG-like 0.039
Further Details:      
 
Domain Number 3 Region: 232-333
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 9.45e-25
Family AF0060-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20808811|ref|NP_623982.1|
Sequence length 499
Comment pyrophosphatase [Thermoanaerobacter tengcongensis MB4]
Sequence
MSELAIVGLGSGSMDSLTVGALKKLEEAERIFLRTAKHSVVKELEKKGFIFETFDSFYEK
YETFEEVYENIAREVIEKAKKYQKVVYAVPGHPYVGEKTVEYILNFCDGCADISIELVPA
VSSIDAILNDLKVDPVEGLKIIDALSLSEQRPDKRCHNIVLQVYDKFVASEVKLKLAEVY
GDTHEVVVIKNAGMRDRKIEKVPIYEIDRLDWIDYLTSLYIPPVKGFFQEKYDIYDLLDI
MKALRAEDGCPWDREQTHKTLEKYLIEESYELVDAIEKEAEDKMVEELGDVLLQVVFHSQ
IAAERGTFDFGEVVDRICKKMIWRHPHVFGEEKVKNSQEVLDKWEKLKWEEKKREEKELN
SYTDVLRDVPRYVPALMRSFKVQEKASRVGFDWDRVEEAFSKIYEELEELKEVYKGENKE
KIKEEIGDLIFAVVNVARFLDVDPEQATHQTVEKFIERFSYIEREARKKGMKLENMTLSD
MDALWNEAKANNFNKKNEK
Download sequence
Identical sequences Q8R7F8
WP_011026477.1.99938 273068.TTE2454 gi|20808811|ref|NP_623982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]