SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20809066|ref|NP_624237.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20809066|ref|NP_624237.1|
Domain Number 1 Region: 14-451
Classification Level Classification E-value
Superfamily Putative modulator of DNA gyrase, PmbA/TldD 3.53e-89
Family Putative modulator of DNA gyrase, PmbA/TldD 0.0000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20809066|ref|NP_624237.1|
Sequence length 459
Comment Zn-dependent protease [Thermoanaerobacter tengcongensis MB4]
Sequence
MKTIDLYQYKELFSVYTELRVQKNTELNITFVNGNIVKNSQSSTSGVSARAYLNGAWGFA
SHAEISEEAIKKVIKEATDNAKFLDAKVNKRKGPLPSRPASIEKDFSTKKSRLTQKELIH
FLREIDEMVSRKYPKIASRKIFLNTLDIEKYLLTSDGSYLKAMIPRSNIYISLSLIKNGE
PVTITDAYGGRGQFEDVFSSPSDFEEKIDELYRHLVNKSEGVLPEPGIKTCIIDADIAGV
LAHEAIGHTVEADLVLGGSVAYGKIGEQVASPLISIVDFANTCFDETCPVPVFIDDEGTE
AKDAILIENGILKSYMHNKESAQYFGVEPTGNARAYLFSDEPLIRMRNTAILPGNDTLEK
MIESIDDGYYLVKASNGQADTTSEFMFGVTLGYEIKNGKLGRAIKDTTISGVAFDVLKTV
TMVSNEIKWISSGWCGKKQPMPVGMAGPAIKCQINIGGR
Download sequence
Identical sequences Q8R6R3
WP_011026707.1.99938 273068.TTE2725 gi|20809066|ref|NP_624237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]