SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20808225|ref|NP_623396.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20808225|ref|NP_623396.1|
Domain Number 1 Region: 2-211,323-405
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.9e-85
Family Bacterial dinuclear zinc exopeptidases 0.000000115
Further Details:      
 
Domain Number 2 Region: 210-321
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.36e-41
Family Bacterial exopeptidase dimerisation domain 0.0000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20808225|ref|NP_623396.1|
Sequence length 409
Comment peptidase T [Thermoanaerobacter tengcongensis MB4]
Sequence
MSKVVERFLKYVKYHTTSDENSNTFPSTEGQLIFARELAKELKELGLSEVEVDENGYVTA
LLSANTDKKIPTIGFIAHMDTSPDMCGKDVKPQIIENYDGNDIVLNKEKGIILSTSEFPE
LKNYIGKTLITTDGTTLLGADDKAGIAEIITAIEYLINHPEIEHGNVKIAFTPDEEIGRG
VDKFNVKKFACDFAYTVDGGELGTIEYENFNAASAKIKIHGRNVHPGTAKGKMKNSILIG
IELQNMLPELERPEHTEGYQGFYHLNNFQGTVEETSMYYIIRDFDKQAFSDKKEYIKSIV
EALNKKYGEGTVELELKDQYYNMREVIEKHMHIVETAMEAMRSLGIEPKVVPIRGGTDGA
RLSFMGLPTPNLFTGGHNFHGKYEFIPIHAMEKAVEVIVKIVELYGKKG
Download sequence
Identical sequences Q8R922
gi|20808225|ref|NP_623396.1| WP_011025997.1.99938 273068.TTE1808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]