SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557687091|ref|YP_008790586.1| from Streptomyces rapamycinicus NRRL 5491

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557687091|ref|YP_008790586.1|
Domain Number 1 Region: 19-349
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.92e-67
Family ADP-ribosylglycohydrolase 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557687091|ref|YP_008790586.1|
Sequence length 374
Comment ADP-ribosylglycohydrolase [Streptomyces rapamycinicus NRRL 5491]
Sequence
MTATASAATGVWGRAEQQDFRSRVRGCLLGGAIGDALGAAVEFASLDEIRAAHGPEGVTD
FLPAYGGRGRVTDDTQMTLFTVDGLIRAQVRRDTGAWHPPTDIHSAHRRWYSTQRDWGPD
ERRKDAGWLAREEWLYAQRSPGRACITGLADETMGTLERPKNPDSKGCGAVMRSAPFGLL
VGWEPQLVFQLAIECAAQTHGHPTGYLSAGAFALIVHGLARGEALDGAVQRALAHLATRP
GHDETTNALRHALGAVRQGLPTPDRVASLGEGWTGEEALAMGLYCALVAEDVRHGLLLAV
NHGGDSDSTAAVCGNLLGALHGETALPPAWLAEVEGRGTILELADDFAMEMTQGPALHGP
GSSSPAWLTRYPRA
Download sequence
Identical sequences A0A0A0NMS2
gi|557687091|ref|YP_008790586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]