SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPU_003211 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_003211
Domain Number 1 Region: 15-117
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000385
Family Heat shock protein 90, HSP90, N-terminal domain 0.028
Further Details:      
 
Weak hits

Sequence:  SPU_003211
Domain Number - Region: 915-986
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.0562
Family BRCA2 helical domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_003211
Sequence length 1247
Sequence
MTPSSGVACMSTMPAKDRIHYYLEETGDKNMVCILDNGKGMTTRELNNWAIFRLSKFNRK
RQRLEQGNNSDGDRDIPKSLNSDISFFGVGGKQAVFFIGDSARMISKPKGSRDVHEMTVS
KEEFERREKNKEDIYGGIIQNRQPGEGSHVSPGNENLQKLIEEEKGQENFTHVVITSIKS
QHIKFIKADFNRWSRQLAHIYHYYIHGEQGNQSHLSNSMYRTPSPYENLNISITMYKKGQ
LHQQLNLRDINDDLQSNFIRSAKDTFDFRVLVEGTGLVEGVLRYHPFLFDKESYPVDDGS
VPEEVDDESDYNKDRPARGSKAIFECYWNGRLIPYTLVQEFDWCAVPKKLVDIPVECYNR
VSGTLFANRKFEVSTNKLTFIDLEMKLKDRSNAVFERVVGGKSLRVNIDEAFYGWLDHCH
ETHDKQVWFRDYVGNITRQGLPKTKQGPWAVFKTVVWDGKVYTTGQQVRILRTNPVVYGS
VKRFLLFGDFGNEIQNRSLFATGGEFEIEQEPRLLYNETKSYHLRRLDRLADEGQIKKAI
DDEEGKLPEVLVISWPKANEVHAGEKRPAGKLIGEIKAEIHNRKGQSMSRLPGVQHNSKK
LMVELKIIWHSDCGDKVIVTHMGQHHKTWAYSFKQMDIVGNIGPHTLILQAVLRDEGATD
LGGRPLPCHKIKFTSTEGPSSKFSIDILDPPFRVDVPFNIPLLLQDEFNNPTKPTPNLKP
VLEASGLVMSYEKVEIEGNSLIVKEVKASGVVGSAQGKKFNMTVTIPGLEIPTQQLKIRI
LPGEPHKIIVPTFEGTGDLCIENGKEFPISVEIRDRAGNFSVHQNIEVQCEFHGADGLPS
YRADCSNSGKVTLTGNPIFIKNISKKSHEITAKIELPHMKGVSSVEKVITVKPSSSACKI
KVFFCKDDPVEIKPQEDIEWTAGQNTSHMRFTLYDEGENQMKITKEQASKFKFTWLRTFD
TSTVMEGNLPPIKVPKSVGDIKFCQLRLTDGSGLEFSFNIKPIPGEAKHIKCQSKKSVKV
KLGEILDGDIVVHVIDEHGNIIKKLPHDSLSNLSVKAEDLDTKVLQKTLLPNVGFSLGDI
KFDGSIVGDRPVLVKYNDFTDLISLEVLPGQPAQLLVMGWMPEETLIAYDGAKINNPLGF
QVCDKSGNPISDVTTPISLQYDKALKVLSTASLTAMPFEGGQVTFGKLTISGPYGKYMLH
AKMSMERSSLMSSGLAVQLKPDPNKAQKLQLDYKEGSVYIAGDHFPG
Download sequence
Identical sequences W4XII6
SPU_003211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]