SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPU_013435 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_013435
Domain Number 1 Region: 2651-2817
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.7e-51
Family BRCA2 helical domain 0.00000569
Further Details:      
 
Domain Number 2 Region: 2818-2952
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.8e-38
Family Single strand DNA-binding domain, SSB 0.0000155
Further Details:      
 
Domain Number 3 Region: 2982-3122
Classification Level Classification E-value
Superfamily BRCA2 tower domain 3.27e-28
Family BRCA2 tower domain 0.00023
Further Details:      
 
Domain Number 4 Region: 3180-3292
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.54e-27
Family Single strand DNA-binding domain, SSB 0.0023
Further Details:      
 
Domain Number 5 Region: 2953-2982,3124-3182
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.63e-20
Family Single strand DNA-binding domain, SSB 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_013435
Sequence length 3879
Sequence
MYIPSSIHTTPNSQIITSHQPTSGPTADTIEEEEEDKGEGARSADIQFSPYPTWNPTFHK
DTPVFMKQLFKTPSMLFGAGDKRACSTPLQRLSTPQRLSRSLGAEPEESDLSWTSSLATP
PMSSKGCKTVTSSTKKVIEDDSWQTHDVAKVLFLDGGSVAEMDSCEEGDEGLTQPLQVIK
LPSITDESQEEEFTIETEDGGESDKSIADGSKAIAALGNEQCSRFDVVGGATSPDNLKND
QAGTQTVTDNSLIPPTTSVQSSMTYNGKPHLAKDEEHESFSECGVPDQYMEEKSSVREKV
EDMDNAAELKSRTIANGECTDTNVTSKLAHGSHSMKNHLHVPIQPTMSSQQSSIIGSSQT
LFNSQESIKNEKSAIEETLAFLLATPPSRREKLLNRLGTSSSGVGETTSFEKAACDAAGS
TLDGESVSPVTSNGVPKKITSDDTLMSPPVGLSWKRTIPGHLSGGPQRNSLESECSVDAK
TNGQAGETPNRPAPDVDMLSPISPNFAEALCRVTDIASREQPSGNKSTLTVQKCLEVERD
LVGDFDSPDPDTAVSHIKVVDQSTSEDHTDIVVKESLHPTEITGKNAIAAHLSAHNTSSL
PSSANNKLPKHLSKQEPSPVVPPSRSLAVSNLNTQTTAKGRFKYTAAVPRKDGASTSKTP
SWLSRAIYVEEDEEEDKTADAVQADTIKDESSKKPWIMKRPCRTATTPNPPSSTQSQTGP
RTSTTPTSSRSIVQSAPPHNKTLVRIREIPHSWPSPKRLRLDEEREECPIGNDLKSLSPA
VDEHDGEITKSTPLESDVKSHHVQDVVSLHVEEGVEDQKDLGDFRDKVNSEDLVPSSEGD
LHQMAPNVGFSSASGKAIFVSPEALKKAERLLEDVDREKPPEEFQLNLSAGDHQCGFQSA
SGKSIAVSDAALSKAKKIIAEVDSHVEEIDDSSEKQPRSLGFTSARGSVINISAAAMAKA
RKIMNDINQDEESNPTLHEKREGQTYAKHPVDGGGDRRRIHNEEVVDKVSLPGHASLKGK
ADGRQRHKGFRPFKAPCLVANIQRPSNLPSPTSISSMNQNTAINVITESERGESLEMYKD
SVPDDLQTPFKQGNAVVPEIQSTTLQVDQKIETSESGIVLEQTKDKQENADSMKGQPVDN
GELEISEDECLSASQATREIKAAEEMELVYNFMQEEDTGFSQLDVSSIVAADRTEKVAAQ
ILKCTDKLKNPIQKEKGHAFNFHEHREMSYHVIEPALTQDFSNEHIGHFIVPEDQHQRDA
PIGITRESTNRNEESPAGNLHKESQHGVAFIKSHSSSRSCESEQSLHSPKCARKEIQDIY
YLKPTEEEGAYETDATNREAPVADLSMNTVRQLMDDSSILMEEPDRVGTLGRKHEVQKEK
ISQVDSHTAYQGNADSTIVFKTAQGQRDEPGSRMDDSNIEGHDLVGFKTAGGKIIQVSES
ALQKATLLLSDCNSDVETMKESSLEISDKLLNQLIPTSSAQDICISDATTLAENVELCKS
EDRNAKASECIPPGDVLQREGMITHINSGCPVIRNDSTSVDEHPPSTLSSSLPALCQVGF
QTAGGKDIKISELALQKAKLVIGENDENPVDHSFDSGSDAHFSACRQDSVSVGFQTARGN
KVHVSRSALRRAKQILESDIEDIRECSPRVSPMLHPNTSDSDTSQNATCKMDNNHKTVQS
EQVPQKCSSVTSTGLFPKTVGFQTASGNSVTVSEDSLSRARQLFAECDAVSGTSSNTESG
LKAARSPKALGFQTASGSKINISDDALQKARRLISHEMKSFEEEEAIGNATKGSISNPIP
TIVGFKTASENCVEISEESLLKARHFMASDTDLSDRRDTAHPDNLVSGATDMNSEIPFPK
ERQGRSSHEDSSDNSSAQRGSVGTKNSAPGQIGFQTARGGAISVSDESLKKAKQLLEDDA
QDGNVQKKREMKQTGVVSSPPMTGFLTGSGKCIHVSDSANLKAKQLLSNDFNEYEDLPDV
EASSAPSHKHPGPVELEIGFQTGGGRRIQVLQSSLLQARHVMCDEKDANQNVLKSESSGQ
RKKDNSEPVDMDSDESHETDALPDQNIVQGFQTGHGKKVQVSEASLQRAKQFLADETDAL
PDQNIVQGFQTGHGKKVHVSEASIQRAKQFLADENDGSPDQSVVLGFQTGRGRKVQVSAA
SLQEARHFLTDETAPLQDQNIAVGFQTGHGKKVQISEASLLKAKQFLAHENDLSQDQSVA
IGFQTGHGKKVQISEASLLKAKQFLTHENVASPDQSVAIGFQTGHGKKVLISEASLQKAK
QFLADDTDEIPNKNIAVGFQTGHGKKVQISEASLLKAKQFLANDTEPLPDQSVAIGFQTG
HGKKVPISEESLQKAKQFLADDPDALPDKRIAVGFQTGHGKKVPISEESLQKAKQFLADD
TDALPDKNIAVGFQTGQGKKVQISESSLLKAKQFLANDTEPLPDQSVAIGFQTGHGKKVQ
ISEASLLKAKQFLANDTEPLPDKNIAVGFQTGHGKKVQISEASLQIAKQFLAHEKDAGTD
ALSKNSAVPGEANENPLSGKPSKMSGFMTGEGRKVQVSEASLQQARNSLGSQAIRNDIGG
ELSNGMLPHGVEQPTLTSRVDGDHLTHQRKDSKEEFHQQERIRESSRGDGSLATPSNLPA
PGGLAKKSMKKVIKPELGSLWRSRKEQDRISLGEFVNHQYPCSMSDSELFGHGILSSTLS
VRPNNAEGYEFAGEDHFSPSCLESDRGIPLDDGGRLVLSPNGLAGKKEFYCALLDTPGVD
PKLLKEEWVFNHYKWIIWKAAAMEVAYPLQFGGRFLTPNWVLLQLKYRYDREIDHSQRPA
LRKILERDDAASRRMVLCVAAIGNTGTSTGHDGKGAEQRKSLQALSHPTLELTDGWYSIP
AAIDPPLANHVRSGKIVCGTKLCISGAELVGAQDACSPLEIPEGLKLKITANSTRRARYN
ARLGLQADPRPFPLPMTSLHPEGGTVGCLDVLILRTYPMQFMEKLPEGGSVFRNAKEEAK
AAALHAGRKQNKMEQLFTQIQKQFEAKQATKGQGGKRRRSLPSSRSRNPVEVEKLQSGEE
LFEAMEAAIDPAAFESVLSERQCSTLHAYRRLQNEVKQADLQAAFNRSLAQQNKEGKFER
TVVPLMKVRVGDYNASTSKGQQTTFLTLWRPPDDLVTELVEGKRFRISSVATSAGRQHPG
SSQYHAVYLADQDAAVMVIKFWTSPAALNLDDMLKPGSFISVSNLQYRSLSSILSAVALP
TATASDYTVFTPNPKAGYLQVALSQLRGAIKDVPKCLELMQRKVQQLKDAPSQPAYPGST
PRNHPYTAGRERVTTPLAGLSRARSGIQSSPPTSVTSQGQPYQLMTVRSCPKNFPKTSQP
TRDENLNPRIQVAGSTPSHSHPGTSRVSTNPTPRTPCQSQVSAISGVDVSPRVLAQHVEL
ERRSQLLSRIPSPPPLSPLPYPAASPALKRGFKIPSPLVRGSQKPDPEKSLRKRLRDELE
EQDIKDSEQQSKQQSDIGFDEGENTYKKQKTDNHVDTSNQKEVKSHTDNQSNLDDEIKEY
ENRGEDDFGDDFGDDLGLSASGLRELEMSWSQSEPLPEPAARDRTLKMNTCRAEEDCPSR
SKDSLDEDKDAIPTDMSLEMDNHHISGLQDEKHVASGIDKAVEGTVEACKDVVGVHETER
DVVPCTEPVQPEQLADHTGVNCDDPTHPTTNNSNLTMTNASETTSICKVEDSSALILPTH
CETVGENLEANGAGILENVKQVTDIPDQVSANLNNRENVKETHAAENHRNSEGSASSNQT
KDATKEDRSQGSILSQQSRGNDSSQNSTPVDGSQGSSKQDESSGPSSPKGNKRKCLSLQR
KRAVPEEAGAVIEILEDDNPPLLKRSSRLRLQQKKSYKF
Download sequence
Identical sequences W4YCF6
SPU_013435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]