SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_018674 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_018674
Domain Number 1 Region: 15-84
Classification Level Classification E-value
Superfamily Ribosomal protein L20 6.93e-20
Family Ribosomal protein L20 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_018674
Sequence length 130
Sequence
MVHLSLVRMIRSRGPDRYWRKRFYLDQSTLWNLRISAAVQEHGLTYGPFIGNLLKHNIRL
DRKVLSHIAIYEPKTFKCLAELASQKHKEGLLATLAKNPEGFLSGPVTQDDLLAESVRKL
RLSSNPSASS
Download sequence
Identical sequences W4YS88
SPU_018674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]