SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPU_002154 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_002154
Domain Number 1 Region: 162-508
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-140
Family Ankyrin repeat 0.00000289
Further Details:      
 
Domain Number 2 Region: 507-851
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.38e-92
Family Ankyrin repeat 0.0000222
Further Details:      
 
Domain Number 3 Region: 1-242
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.84e-84
Family Ankyrin repeat 0.0000226
Further Details:      
 
Domain Number 4 Region: 1238-1329
Classification Level Classification E-value
Superfamily DEATH domain 0.00000147
Family DEATH domain, DD 0.019
Further Details:      
 
Weak hits

Sequence:  SPU_002154
Domain Number - Region: 1168-1229
Classification Level Classification E-value
Superfamily DEATH domain 0.000221
Family DEATH domain, DD 0.013
Further Details:      
 
Domain Number - Region: 1815-1886
Classification Level Classification E-value
Superfamily DEATH domain 0.00323
Family DEATH domain, DD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_002154
Sequence length 1907
Sequence
MTALHNAAKEGHLDVTKYLITKEGHLDVIKYLISQGAEVNKGDIDDLTSLHNSANEGQLD
VIKYLISQGADVNKGDNDGLTALHNSANEGHLDVIKYLISKGADVNKGDNDGLTALHIAA
KEDHLDVIKYLISQGAEVNKGDNNGLTALHNAAKEGHLDVNKYLISQGAEINKRDNDGLT
ALYNAAKEGHLGVIKYLIIQGGGVNRRNNEDWTALHSAACGGHVDITKYLISHGAELNKG
DNDGVTALPIAALGGHLDVTKYLISQGAEVKKGNNDGVNALHSAVFIGNSDVTKYLLSHG
AEVNKGDNDGVTALHIAALAGHLYVTNYLISQGAEVKRGNNDGVTALHIAAFGGHLDVTK
YLVSQGAEVKKGNNDGVNAFHSSVFGGNCDVIKYLISHGAEVNEGDNDGSTALHRAAFSG
HLDVTKYLISHGAEVNEGDNDGSTALHIAVSAGHLDVTKYLISEGAEVNKKDKDGATALH
SAAREDHLDVTKYLISQGAEVNNRDHDGAEVNGGKNEGFAALQFAANGGHLDVTKYLISQ
GAEINKGDNNGLTAFNIAAGIGHLDVIKYLISQGAEVNNIDKQCVSALNLAAKEGHLDVT
KYLISQGAEVNTGDNHGWTALHNATFSGHCDVTKYLLSHEAEVNKGDIDGWTALHIAAFA
GHLHVTKYLISQEAEVNKGDNGGRTPLHHAVQNVNLEVVKVLLAGGARFDIEDTDGQTPL
QLAITIRYRGIADLFVDGSNSKKDLRDIHLAIQHGHISTIEKLVSEGADLNVQSTDGQTC
LHIAIQLCYKTEKSVPETDTLRKISDEYYKGELSPEKALVFYLLENGAKFDVKDKTGNLP
IQYAKDEVVKQMILSRLASLEEIQSYRVERNTSREIELEDHGVSLSIPPEAVYQSDSCKI
NLTLLRDSSSIDIQDDESVACYGIRCDPPNMIFDKPVQIRIPHSTLFINPDQVKPDIVSH
AWDSVHNLPRTSRRISSSSPDEPPYCRVFKRHLELCVGHCAEWWVLIPVEQQVIRHQLMC
TPYIPDTIERGKEIEVHLHIHANLPGMDAEVQEKEKKQAYRKVHPSVPINVSTKSDDVQV
TCYRQGEIEERKVLPLKDVQRKMKHGIFLTVTSREEDTDFPVTITIAQAGKVGVSKSVAF
VIRYTDELKYEPFSEPSSFARVADEVSQSDLKDIDVNTIAGKMTVDQFYDLGVALGFRIP
QLDAIEYRRFRDRQQAIYDVLVTWRQAQASGQEAKETEVPDKTLLAFARKINPEQFFEIG
GKLGLHKTELEHIQHRTLSNRKDANIQMLSKWKASQTSGNQAIETLKLVWKSVQVVQKAE
NLEDKGSSRQIGQTPAEKTKTSEPSCEPEDMEIIRTSNVDDVPSGTPEIHAESLQNLDRH
GGVPDTEELSLIALRVKSLPLACSLGKALRLNDDLIFGFIDLPSSSILHTLARELLDSWW
NGLKLEEREDQFARLLSEYKGSDAKTGREEIFKAIGSKKDVLELCHRLNIKPSGVLQIMC
TSITFPSHIIHRLYSSALKMLNEWIHQGGTRERLLEVAQAFCFNDAAVEIAEEYHPNDMP
FVSHGIIDHKGGELTLRELGITVSIPEGAIPKMMRRSVVTLHVPTHDTPRIPVREGEVVI
TPAVECSLTQKLLKPATVVLPHCIDHHERKDDSSVILYTKTGPVTFGRMNLTPRISTMSK
DKIEFHTRHLQAWAVSSTDLQGILLKCVVFQPLCTTQAEKPTLRVYILHPYSNYVKMPIK
STLRGKCNPLIFELEFSPEEKGKKNIHIDILQGSATLAEREYNISIEGNSIIRRPGGLQY
VSNDLLEILEDVIHAPKELKSLGYQLGFSSSYMDPASVSSDSVSGSGFGEMLRDWRRKVR
PSEQVDELYLALQNAGLGNTAEAIIHGLSITSKRRFAQVRGKWEPKK
Download sequence
Identical sequences W4XFJ0
SPU_002154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]