SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPU_011819 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_011819
Domain Number 1 Region: 42-117,164-201,249-311,360-533
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.12e-40
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 
Domain Number 2 Region: 494-640
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000243
Family Methylamine dehydrogenase, H-chain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_011819
Sequence length 656
Sequence
MPFINSCPPSRLLTRPTTSVYYGYRGFDMRNNLYVLPSGELLYTVGAVAILYDRDLDEQR
HYLGHNEDIQSIAVHPSGTYIATGQKAGQLHESTAHVRVWEVQSLCTHAILGLEFFSEGI
ACLSFSNENDGEWLMAVEQGNDHVISVWQWKEDCVYSKSSASSDAVVCGAFHPFDDTTLV
TAGRQHLYFWTLTDNRLVRDKRSGTWDVRIEEEEEEKEEEGHEEKVEGEDVVRSPAYVTC
IEFSHTGDVLTGDSNGSITVWEKDTDFTFKLRYMVQHAHERSVFTLCMLDDGTLLSGGGL
DRRLLAWDSHSGYTSSKVERLFPENAGGIRTIAPLNPGSPDGLIAIGTTRNHIMEGSLQT
KFKYVLQGHSEELWSLAAHPTKPVFATAGYDQHVISWRADVHRCSWKVHVEKCCVCCAFS
QPSGNVLAVGTTGGRFMIHSSEDGLHITSVQLGKEQIDVIQYSSDGSLLALGSHDHCIHI
FSVMDEGHVYRKLGVLEGHGSFITHLDWSDDGAYLQSVSGNYDLLFWDIDNLQRVKAGTT
RDVEWDTHSCILGYSVLGIWPGQDKGTDVDTLARSTKNRMLVAGNNIGAISAYRYPCTSY
KARSTDIKHHSSHVTAIDFLYNDHYVITAGGHDAVIMQFTLVDKMGDKFDNLADSL
Download sequence
Identical sequences W4Y7W2
SPU_011819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]