SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPU_012673 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_012673
Domain Number 1 Region: 18-245
Classification Level Classification E-value
Superfamily SIS domain 2.22e-31
Family mono-SIS domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_012673
Sequence length 248
Sequence
VRRTVFERGQPRGVLVVGPEARLVRSVLEPICPVPLVAWPFLRLPAWVGPLDLVVALDSD
GHCAAQVAEARRRGSAIIMFSTGETESWQAAGSHGTARIQMASEDALSAAVAALSVLSDL
GLGPVVDPGQVARVADMVAESASPHHDLAVNEAKDLACALADAEPLMWGGSVLAARASRR
LAQWMRRATGRIALSADSAALRPVIDSAPKRDPFADPDLDGETRRPVLVVMDDAEMEHAA
ARRDLEQL
Download sequence
Identical sequences SPU_012673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]