SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPU_015011 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_015011
Domain Number 1 Region: 10-126
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000000000275
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_015011
Sequence length 127
Sequence
MGIGLPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK
ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNL
TLVNTDQ
Download sequence
Identical sequences W4YGX1
SPU_015011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]