SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPU_016417 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_016417
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily SIS domain 1.07e-31
Family mono-SIS domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_016417
Sequence length 159
Sequence
MVYVFGMGGASAVLAQEVQSRLVRLGYPIAVYSDAVLLRMVAATLDERDAVVILSASGLT
PEIVGAARIVKQYRARIVAVTDATSELAKLADVVLPIRTDETDFIYKPSASRYAMMLAID
LLSTELAMLNQEENRERLRRIKLALDEHRGGPNRLPLGD
Download sequence
Identical sequences W4YKV1
SPU_016417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]