SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13541335|ref|NP_111023.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541335|ref|NP_111023.1|
Domain Number 1 Region: 1-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6e-23
Family GHMP Kinase, N-terminal domain 0.0075
Further Details:      
 
Domain Number 2 Region: 184-324
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.99e-22
Family Galactokinase 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13541335|ref|NP_111023.1|
Sequence length 329
Comment kinase related to galactokinase and mevalonate kinase [Thermoplasma volcanium GSS1]
Sequence
MILSYSPLRITFGGGGTDIEPFVSKYGGAVVNATIDRGVTVRYIDDGYQTELSSRDFVKS
YIINMHGPSTVSSRMLDYLLRSGLRTGRIIMSGDVPPGSGLGSSSAAMSALVNLTSIIRK
TKYNWESIARESYNIEKNYFHIVLGLQDPYAIALGGFKFMEFNGDGVKYEMLDKYGDFTS
ELEKRIILIYTGHTRQSSEVLIDQVRAATQGDQETTEKLLQLKEVAFRLRKAVIDNDYSE
FDQAINYGWEIKKTLGQKTTNRRVDTIIESALKNGASAARLMGGGSQGFILVLSRPGKIN
ELQRAMMNASNFVVRTSFDKRGTRRLFIR
Download sequence
Identical sequences Q97BF2
WP_010916762.1.10044 273116.TVN0504 gi|13541335|ref|NP_111023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]