SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13541674|ref|NP_111362.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541674|ref|NP_111362.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.31e-45
Family Transposase IS200-like 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13541674|ref|NP_111362.1|
Sequence length 134
Comment hypothetical protein TVN0843 [Thermoplasma volcanium GSS1]
Sequence
MELKSTRHVKYLCNYHYLWIPKYRRAILTNEVAEYTKEVLKSIAKELGCEIIALEVMPDH
IHLFVNCPPRYSPSYLTNYFKGKSARLILKKSPELRRYKKLWSRSYFVSTAGNVSSETIK
KYIEEQWVKEGEEG
Download sequence
Identical sequences Q97AF3
gi|13541674|ref|NP_111362.1| 273116.TVN0843 WP_010917101.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]