SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13541719|ref|NP_111407.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541719|ref|NP_111407.1|
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-30
Family GHMP Kinase, N-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 184-303
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.56e-27
Family Mevalonate kinase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13541719|ref|NP_111407.1|
Sequence length 324
Comment kinase related to galactokinase and mevalonate kinase [Thermoplasma volcanium GSS1]
Sequence
MIITKTPLRITFVGGGTDIPEYYRKKGGAVVSAAINKYIYVIVNKKFDNKIRISYSKTEM
VDSVEDIEHPSVRESLKLLGIDGGIEILSISDIPSKGTGLGSSSTFLVGLLNALHAYKGE
LTSREELAREAVLIEREILKEPGGKQDQYMAAYGGINLMNFNQDESVYVRPLSINAKSLE
DFRNHLLLLYTGIQRNSTDIHKKQREEVIKKEEYYDEMKELAYTFFEAVYKAEYPRIGAI
MDANWKNKKKLTDGISNDIIDNLYELAMKKGAYGGKLIGAGGGGFLLFVCEPSDSDDIIK
ALSLRKIDFDFDFEGSRIIYVSKD
Download sequence
Identical sequences Q97AA4
273116.TVN0888 WP_010917146.1.10044 gi|13541719|ref|NP_111407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]