SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13542149|ref|NP_111837.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13542149|ref|NP_111837.1|
Domain Number 1 Region: 10-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000243
Family GHMP Kinase, N-terminal domain 0.0083
Further Details:      
 
Weak hits

Sequence:  gi|13542149|ref|NP_111837.1|
Domain Number - Region: 211-244
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0048
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13542149|ref|NP_111837.1|
Sequence length 268
Comment shikimate kinase [Thermoplasma volcanium GSS1]
Sequence
MKFAEATTNGGISILSAFIDGLGGAFSIDLPLTATVYAGTRRREDRLMEAIRSEFGIKDQ
LTYKVKSSIPAGYGLKSSSALVLALAKASLLYKSVDIEDADLLVRLANISKAVGLSATGA
LDDLCQALYGGYCITDNKRMKIIKRGKLPELAVLVCARGETRPSRSINIRGNYFKVARSA
ENLAQRGFIFQAAVLNGFIYGTIFGIDLETVRKIEENGANYASQSGKGPAVFGLFTDPSD
AKRAKMDIGFGIVTKINNHGIRYRIYDS
Download sequence
Identical sequences Q978S4
273116.TVN1318 WP_010917576.1.10044 gi|13542149|ref|NP_111837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]