SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13540909|ref|NP_110597.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13540909|ref|NP_110597.1|
Domain Number 1 Region: 7-330
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.26e-39
Family AAT-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13540909|ref|NP_110597.1|
Sequence length 335
Comment histidinol-phosphate aminotransferase [Thermoplasma volcanium GSS1]
Sequence
MRSHGGDVYKVSPNYDRITDMSSNVNPFLDLGKYSLYPEISYTDIEEKLRVYTKSTNMGI
VIGPGLTHLIYKYFEFYQVKKPIIAMPNFSEYKGIAEDRHLRFSAIPSYIIEKDPLILKN
FDHDALFITSPSNPFGELFPESTLETVFEIEEKRGRRVFLDGAFMDFVPNYAESIVQSSR
SYFNVTIGRSLTKILAIPSLRAGYLIMERHEADLFRKAMEPWSICQPAIDFIRSIDINEV
AKNSVALVNGEREYLISELKARGIKVIGNPSANYIVISMPRTDEFYNFMLSKGILVRLLD
DYDYVGRCLVRLAIKTRSQNNAFLNALDNFMSSSE
Download sequence
Identical sequences Q97CM4
WP_010916334.1.10044 273116.TVN0078 375743 APC88567 gi|13540909|ref|NP_110597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]