SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13541128|ref|NP_110816.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541128|ref|NP_110816.1|
Domain Number 1 Region: 2-431
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.43e-82
Family Glycine dehydrogenase subunits (GDC-P) 0.000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13541128|ref|NP_110816.1|
Sequence length 434
Comment glycine dehydrogenase subunit 1 [Thermoplasma volcanium GSS1]
Sequence
MDEISSMLDYLGIKSTEELFSDIPLSVRKKEIGIGSPLDEHLVLERARKYASLNSTEMLN
FLGNGIYDRVIPEAVNYIISKSEFLDSYTPYQPEVSQGMLQSIFEYQSLISDLFKMDFTN
ASMYDGYSALGEAARMAYRINGKNKILIPESTYDSKLSVLKNYVWGLSMKIEKYKMNEEG
KIDIDDLQSRIDGDTSAVVVENPNGYGVIDENVFRISEIKKESLLISYVDPISLGVLKPP
GEYGSDIAIAEGQQLGIPMNFGGPLLGIMSFKADYVRKSPGRLIGESVDADGKRAFVMTL
QTREQHIRRAKATSNICSNQALLTLAAGSYLSILGSSGLKKVALLTIKHSKNLAESLGNI
GIEKVFDSISFSDTLFRIDKNVMLDLAKKGILGGIKLTSLIKDSKYSSGTFFTATEKTDN
EKIKALVNALEVIM
Download sequence
Identical sequences Q97C05
273116.TVN0297 gi|13541128|ref|NP_110816.1| TvR8 WP_010916555.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]