SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13541129|ref|NP_110817.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541129|ref|NP_110817.1|
Domain Number 1 Region: 24-472
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.3e-103
Family Glycine dehydrogenase subunits (GDC-P) 0.00000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13541129|ref|NP_110817.1|
Sequence length 472
Comment glycine dehydrogenase subunit 2 [Thermoplasma volcanium GSS1]
Sequence
MNFKQAYYEEPIIKDIKSSNTFSLSEQVDESILPENLKRKDLELPEVSEYDVVRHYTRLS
QMNYTVDVGIYPLGSCTMKYNPKFADRVSAIDGFRNIHPFQPENTVQGALHVMYDLQEYL
KKISDMDAVSLQPMAGADGEFTGILIVKKYFEDKGEDRTEIIIPDSAHGTNPASATMGGF
DVVEVPSDDKGMVDLEALRAAVSKKTAAFMITNPNTLGIFEQNIEEIAKIIHNAGALLYY
DGANLNAIFGITSPGLMGFDIVHFNLHKSFATPHGGGGPGAGPVAVKSFLKDFLPVPIVD
FDGNSYRLNYELKKTIGKVSSFYGSFSILLRAWSYIIRNGDDGLKNVSARAVLNSNYLKK
KLEKYYDIPYYPLKKHEFVLSTENTGKRALDIGKYILDNGIHSPTVYFPLIVKEAMMIEP
TETVSKADLDNYADVLIEALKLSDEELKSRPKNTAVRRIDEVKAARDLKLKW
Download sequence
Identical sequences Q97C04
WP_010916556.1.10044 273116.TVN0298 gi|13541129|ref|NP_110817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]