SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13541257|ref|NP_110945.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541257|ref|NP_110945.1|
Domain Number 1 Region: 41-203
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.23e-21
Family GHMP Kinase, N-terminal domain 0.0065
Further Details:      
 
Domain Number 2 Region: 227-349
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000000000949
Family Homoserine kinase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13541257|ref|NP_110945.1|
Sequence length 369
Comment mevalonate pyrophosphate decarboxylase [Thermoplasma volcanium GSS1]
Sequence
MEISKFQSLGDKIRTMLEDHGYLSENNDYEPNPIDGNISISYAYPIKAFEKFLGYYDVEN
RVAYNPSISMRTDFSYCIAACRYNKNGNEDTVILDGVTDEKYLRKAKFALDYFRKEFRIK
GSFDFYIRRYRRYTKAKGLSESSAVAAAVSRALIKNVFGEGPALDDVFVSKYARLVSGSG
TRAAHSGISIWLSYPGINLRECAAFRVADDPHDVYYGIFPKYTDIATDSAHSVAVKSIFY
ASWLEDKYANIKRLIEHNFDIDELLISGENDMLKLNAILFSGGLIIQTGESLRILRAIQD
FKKNGDLFFTADTGPSIMVLSRDKSLIEELRQSVEDPYIEGTYNFNRHTRDLNNFTKEAN
EYFLENKIE
Download sequence
Identical sequences 273116.TVN0426 gi|13541257|ref|NP_110945.1| WP_010916684.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]