SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13541402|ref|NP_111090.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541402|ref|NP_111090.1|
Domain Number 1 Region: 4-354
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.43e-83
Family Cystathionine synthase-like 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13541402|ref|NP_111090.1|
Sequence length 380
Comment aminotransferase [Thermoplasma volcanium GSS1]
Sequence
MLRKLMHVGPSMTSYEVQLEGVRENVGFASPEFLEAMRNSLEGLRIVVGADNSYLPFILP
GSGTVAMESVTSILPRKGKVLVASNGVFGNRWKPILDAHRMEYEVLEAEPGKSVDPASIK
DKLSSGNFASLVFTHVETSTGVRADIEEICRKARPLVDRIVVDGVASVGGETLKVKEWGI
DAIITASQKGLASPPGAALLVVAKDSLNNTAGDGYFFDLKNWVEPMNTYLKGENGYLSTE
PVGVVMALSHVFNDIRAEGLENTIKRHRVFSEALNEGLEEIGLKVLADREHWSNTVTAVV
AERSDDIVKFALSMGIEFATGVHPKLKGKYFRIGHMGYFNYYDVFSALSVIERSALRAGI
NIKLGSGLTRAQEILIKNGV
Download sequence
Identical sequences Q97B87
273116.TVN0571 WP_010916829.1.10044 gi|13541402|ref|NP_111090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]