SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13541627|ref|NP_111315.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541627|ref|NP_111315.1|
Domain Number 1 Region: 4-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.96e-98
Family GABA-aminotransferase-like 0.0000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13541627|ref|NP_111315.1|
Sequence length 387
Comment glycine hydroxymethyltransferase [Thermoplasma volcanium GSS1]
Sequence
MRKILSIVQDADIYRSSVINLQASENVISPNVRRALASDFASRYSHKENGVNDYGGTKYA
EELEESVNELASEVFNFKYADAKPLSGHVAAETVLAALVKRGESIMKIPERNGGYQGYLN
GYLPSLMGFRSYDIPMKPDQAIDFESFEKTIDYIRPKVVILGQSVFVKSYDIPKVRELCN
SVGSMLLYDASHVMGLIAGGTFQKDIGLCDVVFGSTHKTFFGPQGGIILTNEAEVFDRIE
KKITWITMDNFNISRMAGVGVALEETKKFGREYASRVVKNAKDLAKELDGKLPIKYSPWF
TESHQVLIDEEGLKKDGYDTIKFSEDLEKNGIIVDRIGRIGTAEITRMGVDDVQPIADMI
KDAYIGKDVKERVNKFVSNMKMRYYES
Download sequence
Identical sequences gi|13541627|ref|NP_111315.1| WP_010917054.1.10044 273116.TVN0796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]