SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28493295|ref|NP_787456.1| from Tropheryma whipplei str. Twist

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28493295|ref|NP_787456.1|
Domain Number 1 Region: 53-360
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.08e-58
Family L-arabinose binding protein-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28493295|ref|NP_787456.1|
Sequence length 361
Comment sugar ABC transporter substrate-binding protein (L-arabinose/D-xylose) [Tropheryma whipplei str. Twist]
Sequence
MKGFGMSISKGLFRAVLFTAAASLFLMSCLGGGRDESKTGGVSYTKGFPSDSLIGVAITK
KTSQNQVDAGNFFEELLKDAGFKSKVVFANNGVSEQQSQIDNMIASGAKVIVVNAVDSSL
LGPQLKRARQAGVIVFDYDRLLENTKDVDFYVTYNARTVGILQANALLQGLEKKKPGGPW
NIELFAGSPDDSNSRIFFDSAMSVLNEKIKSGKLIVVSGQTDFAKAVTQDWSAENAQKRM
DVLLSTYYNTKQLDGVLGPNDVLARAILRSVELAGKPVPVVVGQDAEEPSLKLIAAGKQY
STVAKSTRALVEATVKAIKQLADKKLPETNSKSNNGEVEIPTILLTPKIITKENLDTIYK
K
Download sequence
Identical sequences Q83MX9
203267.TWT328 gi|28493295|ref|NP_787456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]