SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28493528|ref|NP_787689.1| from Tropheryma whipplei str. Twist

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28493528|ref|NP_787689.1|
Domain Number 1 Region: 65-397
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.05e-62
Family L-arabinose binding protein-like 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28493528|ref|NP_787689.1|
Sequence length 398
Comment branched-chain amino acid ABC transporter substrate-binding protein [Tropheryma whipplei str. Twist]
Sequence
MNKLRVRVLFAASAALLFFSGCFGSGDNKSSAEHIVLPKVTAPVSFKNALFPAGDGKAVC
PKGLSIAYVGIVTGPNAAFGKSINEAFQLAVKQHNDNNPGCQVTGKVFDTEGSPDKAPGV
VAQVIGDSSIVAVLGPAFSGENQAVGGIFETARLVHITPSATLPTLSSHGWKTFFRAAST
DLEQSTGVIALLEKLEAKKTFVVSDDSAYGKFLGDLVKKGVDLAGSDGIITGSRDFSSVV
AKVVSSGADSVFFAGYYPEAAAFFTQLRGAGFNGYLVVPDGSLDRNLSKLAGQAAVGVYA
VCPCTDDSQVAGFGDAMKKAYGHYPGIYSSSAYDVTTILLRGIDSGRTSRSSLLDWVRGY
DAYGVSGHYKFKANGDLQHTRLYFYRFDESGAPVLVGE
Download sequence
Identical sequences Q83MT4
WP_011102644.1.36967 203267.TWT561 gi|28493528|ref|NP_787689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]