SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 82762.m00228 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  82762.m00228
Domain Number - Region: 7-50
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0392
Family MesJ substrate recognition domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 82762.m00228
Sequence length 73
Sequence
MDSKISLKSEVDYLEGLANYLSLQIVEHGGELDFDVTKPLSSDLLRQAIDNINKFVKKPE
EDEEHPPTKAIIE
Download sequence
Identical sequences A2E2X2
5722.A2E2X2 gi|121908146|gb|EAY13027.1| gi|123488807|ref|XP_001325250.1| 82762.m00228 XP_001325250.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]