SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 88428.m00071 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  88428.m00071
Domain Number 1 Region: 8-229
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.67e-52
Family PP-loop ATPase 0.0000504
Further Details:      
 
Domain Number 2 Region: 354-437
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.57e-20
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.017
Further Details:      
 
Domain Number 3 Region: 207-310
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000194
Family MesJ substrate recognition domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 88428.m00071
Sequence length 444
Sequence
MDKIFYENLIKLNIIKKSDKLSLGVSGGADSMYLFYNFMDLKEDWNLDIIVCHLNHGIRE
TAKRDEEFVKKSCQAYGIKFISKTVNMDEFAREKKFSSEEAGRILRYEFFRENSQGRKIL
TAHNANDRVETVLFNIMRGTGLKGLSGITHVNGDIYRPLINIKREEIEDYLHKNKLQYFD
DETNFEEIYTRNKIRLGLIPELKKFNPYIINSLLRLSDNVEEANEFIGEILEENYNNCLG
DNFLIPSEIIKLKKLIAQEVIKKYLEENFYSENILNRFNILAIYDLCLGDSGRRIDLGKN
ISARRSYDKIYIEEVMGQEEKTKKGLSIGRNATDFGEIFITRDGEESPEDSFIKVIDYDK
IKGSLKVRKRAPGDRFKPLGMKNSKKLKDYFIDRKVDRLLRDEIGLICDDEKIIYILGMD
ISEDVKIDKKTKNKLVLEVKNVRY
Download sequence
Identical sequences A2FJA9
gi|121889608|gb|EAX95023.1| gi|123430775|ref|XP_001307953.1| 5722.A2FJA9 XP_001307953.1.43485 88428.m00071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]