SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 80470.m00065 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  80470.m00065
Domain Number 1 Region: 373-620
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000265
Family Tropomyosin 0.00082
Further Details:      
 
Domain Number 2 Region: 624-877
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000105
Family Tropomyosin 0.0011
Further Details:      
 
Weak hits

Sequence:  80470.m00065
Domain Number - Region: 2028-2138
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000628
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number - Region: 2064-2316
Classification Level Classification E-value
Superfamily Tropomyosin 0.00128
Family Tropomyosin 0.00035
Further Details:      
 
Domain Number - Region: 1392-1490
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00288
Family Myosin rod fragments 0.0036
Further Details:      
 
Domain Number - Region: 965-1082
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00471
Family Myosin rod fragments 0.0055
Further Details:      
 
Domain Number - Region: 1711-1817
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00549
Family Myosin rod fragments 0.0032
Further Details:      
 
Domain Number - Region: 1942-2034
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0238
Family Myosin rod fragments 0.0078
Further Details:      
 
Domain Number - Region: 1621-1724
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.0064
Further Details:      
 
Domain Number - Region: 1108-1290
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 80470.m00065
Sequence length 2366
Sequence
MSENRRSSNATDGSKSEKSQNQYLWELTNGLVKVHDDIDIIDQKIGKSSAQDRSFQMNPK
SIFPRLEIVCKNLDEYLTERQNQTDNQIKESKENQAKYEATLRQAVKKHNQLTKLLQDRE
QAIARSGEEVENLNNKLDEAEKKLKDTLNDLNPKIDSLTAENENLKKQLQEQAPKLADMD
NLTKSLKKLTRMQEKAKQELENQKKQNADQENKYNQDIDALNKELQNQQQDFEKQKNDLQ
DQLKRLQDQLDKQTAESQQLKSQIENKDLEGKDKDSEIEKLKKLLKDKDNKSKNDLDEAN
ANIDDLNKQLDQLRNALKDANKQKAAALDDLEKERDANSDLKNKLEDSDKKYKLLENQQN
QSEEGARSKLAGMEVEFARLQKENNDLKPKLQDEVAKNKELQNQIENLQDQIDELKRSLA
EAQKQIKDKEAEIADVKNQLQGVEASQQQQNANAQDTLKDKDAKINDLNNKLKDNNKAIN
DLQNQLDNAKNELENLRKQLESKQNELKDAEKKLNDAKRKNKDLETENEALQDQVDSINT
DKEQQGDELANLRKMLSDQTANFKKNNEDNKKENEKELAKKEAENRALQNQIDQLKKLLQ
GSEEDLKNAQNELQAKDKDLAKAQRENERLANAQNQLQSNLEEKKNLDDELTDLKSKLAA
IENEKQKAERENERLKAMNDQLEKTSDDLNKKLTDETRERIKLDSQAKAADRELQTAKAA
SEELSKTNEQLDNFNKDKDNKIKELQSKVNDLEKKSNQLDDANSRIKELEDELSESEASK
DDISNKLNDLQKKSNDLQKKSDQMKKDLDDSQQENAKKQKENEDLQNQQRDLDKKLKAAE
KRIQELLGENSDLHETLDNINTSSMQQGDEMNKVIAEQAAKIKALQEAVNNSQPKGEDPN
ELHDKINDLMAQIKALQQKNNELDKENKELEAAKEASENENNDLKNDLQTKNKALSKAER
DNDKLQNANKALDEAKEKIKALEDEVSDLKALVSEKDGDLQKEKRENERLVANKDQLTKN
NEELYDQLKNETTEKIKLDGQVKNAERDLAKANATNEELTKSNEHLQEQNDEKDAKIKEL
QAKLNELEKKLSELPGLQDEIAKQKETNNELQNNVNDLEKAGKDKDNKINELQKKANELE
NTKKDLEDVTNELENTQKDLDNSNNKNRDLEKQIKDLKKQIEDLNREKNDLKDQLDTSKL
AGDELSKRDEVLDNLRKQIAELAAKNKDLENKANDNNAEELAAKEAELENINKQLEQTKK
ELAERDEELKNAKNENLAKEKENQKLNRENERLKFEQQDLKDLEEENKNLDDENAALKSK
VNALENDLQKAKRDADRLKLNNDQLQTNIDDLDNKLKEESAEKIKLDAQAKAADRELQSA
KAATEEEKKANDQLQGQIKDKDNKLKEMQAKLNEMQKKANDADRIQNLANSLKSQLDDAN
KSNNEKDNQLNELQKKLNEAQKKANQLEPTKQELEDARNDLNEKQKELDASNNKNRDLEK
QIKDLKKQIGDLNNEKQALKDDLDTSKLADDELSKRDEVLGNLKKQLADQLAKNKELEAK
VKGDNGDELAAKDAELDALKDQLEQVKKDLAETEDELKNARNESSAKDKEIQKLARDLEH
LKDAEDDLEKANEEIKNRDAENNELKGQLANKENELQKSKQENDRLQLSKDQLSKHNDDL
NNQLTAATTDNIKLDAQVKELERRLGTNNAAQEQQAQTIEQLKSEAADKDNKIKDLHDQI
NNLQKKANDADNLQQQLDYAKSQLDEANKSNNDKDNQLNELQKKFNESQKKANQLEPTKQ
ELEDSRNDLNEKQKELDESNNKNRDLEKQIKELKKQIEDLKKQKDDLQEQLDNNVKADDV
IDKLRKQIAELLAKVKELEAKNKDNTGDELAVKDAEIESLKNQFEQAKKDLDEKELELKQ
TSDNLSSKDKELQKANRELERLQDVDQELAQANEENKKLDAENGELKTQLANTENELQKS
KQDNERLQSSNDQLTKNTDDLNKKLTDETTDNIKLNGLIQELQRRLANNDAAIAQQAESI
DKLNEQAADKDNKIKDLHDQINNLQKKANDADNLQQQLDYAKSQLDEANKSNNDKDNQLN
ELQKKFNESQKKANQLEPTKQELEDSRNDLNEKQKELDESNNKNRDLEKQIKELKKQIGN
LDSEKQALQDKLDDIKLADDAISKRDEVLDNLRKQIAELAAKNKDLENKANDNNAEELAA
KEAELENINKQLEQTKKELAERDEELKNAKNENLAKEKENQKLNRENERLKFEQQDLKDL
EEENKNLDDENAALKSKVNALENDLQKAKRDADRLKLNNDQLQTNIDDLDNXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXP
Download sequence
Identical sequences A2FQ07
XP_001305955.1.43485 gi|121887503|gb|EAX93025.1| gi|123421283|ref|XP_001305955.1| 5722.A2FQ07 80470.m00065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]