SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 81616.m00165 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81616.m00165
Domain Number 1 Region: 298-482
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.99e-32
Family cAMP-binding domain 0.00064
Further Details:      
 
Domain Number 2 Region: 166-333
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-18
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 81616.m00165
Sequence length 543
Sequence
MRNTYLYNPDADQKSISEPVRPAPSKVYEPLRIENSIATIATIAGYRKPKVLFSHFSLLR
RIWEYALLIISVIPAFEIPFFSIFIYDYKTSLYWPFMIFDFIYMADLYVVLNTSFVSHGV
IVSDKKRILKLYGVKSVIFHIIACIPGWWFGVFFNNRSAYIVLSLLKVFRLNRCMIALHT
TKSNLVYYSWFSALLPLVICFLLVVHLFACIFYLSAFLSKSPDTWITILGWSYLTPPQLY
VTSIYFVLTTIFAIGYGDLTPQASCEVIVVIFIQLFGVTSNLLILSKLVELSLSGPDKSY
VRETREFRDYLAFKRIPKKIREETTNYFQMRYDESRGADEPAQVLRYLPDTLRTSLVLDQ
CRYSMMQVDLFRVASQNFLSAISKMLTPHAFIPGETIIKQGDVVPELLLLNSGILSISVD
GIEINKLEFNDGFVSGEIELFIDKPREATIKAVSHVSGWSLSRLQIQMVVAYQPDLRREI
ISISKMIYPDNVREIKNLISVQTLEAVLKDASDTESSYSDSDIFLGTKIMTSSSDDDTSF
ELL
Download sequence
Identical sequences A2DY06
XP_001326965.1.43485 gi|121909887|gb|EAY14742.1| gi|123496417|ref|XP_001326965.1| 5722.A2DY06 81616.m00165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]