SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 81840.m00206 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81840.m00206
Domain Number 1 Region: 96-178
Classification Level Classification E-value
Superfamily E set domains 0.000000000747
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 
Weak hits

Sequence:  81840.m00206
Domain Number - Region: 25-89
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000471
Family Growth factor receptor domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 81840.m00206
Sequence length 253
Sequence
MIFISLFILSVKYNPSDDPKSGIKCKGPHTFVNGTGKCECSADFPFGDPSSEIGCWTCNP
PCDLNAHCYGPDQCRCNEGFIGDGLDVCEKPVPSLKNFIPKSGSVNGGEKITLFISVIAP
NYTAIKGFCRIGPMIYDAISVNTTHITCITDKSKPGSFPVSASFDAVHWSTDNATFTYNA
DGATQVSIFFGLFSTFLIILLGYMIFYYLQKTDKFMEQADEVLPLTKWHMNTPHITPQAE
QTWFDFLWNIIIE
Download sequence
Identical sequences A2E0E3
81840.m00206 5722.A2E0E3 XP_001326046.1.43485 gi|121908955|gb|EAY13823.1| gi|123492389|ref|XP_001326046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]