SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 86319.m00258 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  86319.m00258
Domain Number 1 Region: 114-187
Classification Level Classification E-value
Superfamily E set domains 0.000000187
Family E-set domains of sugar-utilizing enzymes 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 86319.m00258
Sequence length 264
Sequence
MLFFFLFSDSLEKRRRRDRHQHRDYQYFRPEQEIFPPDQIQGSCDGANTIRILSGECKCA
QGFPFGDPSGIQGCWNCEDDCNDDAKCIYPGICQCIPGFKGDGVRECEPITPKLLSFYPK
SGKAGTNINISYSMLNNSNPLNAYCKFGSIPIDAKFVTSNYIICEVPKMKSEDALLTISL
DAMAWSTEEFYFKVKGESDPIRLFPFILGSIVIVGTILYALNKVAGDTRKKKYDDHVPFL
KLGSKKNDGISPFELFKKKGKLLI
Download sequence
Identical sequences A2DIJ3
gi|121915004|gb|EAY19797.1| gi|154415517|ref|XP_001580783.1| 86319.m00258 5722.A2DIJ3 XP_001580783.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]