SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 87022.m00161 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  87022.m00161
Domain Number 1 Region: 300-480
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.19e-34
Family cAMP-binding domain 0.0012
Further Details:      
 
Domain Number 2 Region: 170-309
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-25
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 87022.m00161
Sequence length 547
Sequence
MIRTSSMVNLLNDDDWKLTFTEPGLPKKKSQFQAAPENFYSQSAIAPNSTKLFYFTHFNK
WRRLWEYILLIVSAFPFFEISFISIFCPHVSMLRFSPLFIFDIIFGIDIFISSRTAYLSQ
GVSVTDPDRIFRRYGKVWFVFQIIATIPLNWIGVLKGNRYLYLALSINKVIRLRRAFTAA
EYLLKFLMYHNWKSIMFPFCLLLLCFAHFFACLFYICAVFEDTMESWIGMSGWDYLSPPQ
LYVVSVYFVMTTILTIGYGDLTPKTSPETILVIFIQLLGVLVNAYILSIMVSILIDPIGN
EFIQRFISLSDYMHFKHVPPNVRTDIKQFLQMKWQTNHGTEDPENVYKFIPETVRDNIKR
DICRKCFSKVSILRMASESLLTEMANLLRDISFSPGEVIVKQNVMTHDMILLNNGIIDIY
ADGSLVASSACDDGLVLGEQELFVDTPRAATVIAVTYVEGWIITRDFLIQCLAHRHELKK
DLLDSALVCFPAKYKEIRKLLSGENIRATVERNKAKQREMIQRILRNHRDQNNTDDDSSS
DSNHLGI
Download sequence
Identical sequences A2ENC9
XP_001318022.1.43485 5722.A2ENC9 gi|121900771|gb|EAY05799.1| gi|123469623|ref|XP_001318022.1| 87022.m00161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]