SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 87328.m00133 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  87328.m00133
Domain Number 1 Region: 1790-2052
Classification Level Classification E-value
Superfamily BEACH domain 7.85e-60
Family BEACH domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 2184-2362
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000125
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 685-856
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000222
Family Clostridium neurotoxins, the second last domain 0.042
Further Details:      
 
Domain Number 4 Region: 1709-1778
Classification Level Classification E-value
Superfamily PH domain-like 0.0000393
Family PreBEACH PH-like domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 87328.m00133
Sequence length 2371
Sequence
MIDHLKETSNREIITKIVEKLSKLSEDNDKFFSCLCKLCQKFYNSKSNSYAEHILEKISD
IIHIYNQKSYTYDDTVVCQIVQNRLNLFEISIYKCFSEITYRKQNECLSALFLSLVSSIQ
DVSNSNPGKFKIPESTNLEFSEFTEKPSYSSTDFQHNVEYQSIFDTKVPGINSCLNYSSI
FNENFYEKIKLVQMVFQSAKSYLTDIFFSNMSKYGFLNDDVQPYLCFLLLLQESKGFSTG
IFDAIINYRIFDPSIHMFCPPKDYEYIAFIRQLALQTVVAKMPTMLPKVLEKHVNHQFLF
SELCLRIQSMIKNGVVFEDRHFTLFIEVEHKLRKIYEISEDYREIAIKARSSIFVLIYSI
MNSPAITEASYSSKYFSTCFLTAFFEPHFSDLVFEKLRSVFQVASSEIEQTTDFVANALK
TLKYNTSTSYTSSLASRLLASVGDSIPLNTSLALYCENVLKNAIEYTEAFPSQSFLTQIM
QLSLQMFLYHLDFEYDLITTTKVSKIIRQLEGPELSDAIKQKLLCFLSASQSVHQNFLSL
IRKPSVLTLMFSVYSCGKHFKELFKLLNDLINYSSYNLLMIHKGEVDLILCDMVSNFPNS
FFFRGCEIDNFSDESEIINMIMPLFNKLISIKSSTIVAQRILNIMNPKDGKFNPLVFQFL
SQFFLTIKTIQNLPSILYPIAMNKTFWSVSNLNKKNFFTENTISFWIKVDQALANPLNKK
LSILRGNYSDGRHFFEISIRQSHVYFEINLGEKSAELQIAELDNSNWNCIAIVFRRVPDK
KNVRITARLNQNKPQSSTIDSCLDQDDLFSINFGNNCEINQIDTEKLICSYQISAVNCYS
KVISSEESDTVALNSLDFVLPNVPVLFSFNIKEKNPTDKKQKTSVQIQELFGLQNVHKIM
PNINDIFSNYIPMISFVPVFGKLENSPKDYSCVLVDFIFYCFGKQILTVIDEIPFYLAKS
PSEILTYQLYRRFYNLIDLFTTNDELAVFVNKILMNGELWAKSPPSTIQKVLSHWSTALI
EIIRENDKILNIDFYNKILSVYRKYFFLPDEKKTKVKEIKEENNDYENPNEMYNEMKEIE
FDKNNNLQNEKVTNDQKVTEKQNILENKNSQNDNNLDQKVTNHQNILDENKIIQNEKSNL
EEKVIEISENQDNKSDLDQKSLSEKVTESENLQNEKDSNNNENNVQKVTNKNDNFQLNEK
TKRISQSSDKSIEMKKQNISKNGLDLNMILFFFDRLISELSPNFYNDDLIELFISHGIFC
ENKTLTSRILGLLPTLLHYHRKCPIDVTQMMHLVSLQNQKEFIFIFLYSIQVFYPSELYK
QSILLGYHIPQDIKYEDICSFEGELNPLSAFPIILIVSLRSSSETQKSILEKYEHLTTNK
DNCKEITSHSHWYIWFILFALQVDPTLHPRSSDVLSNLILSDFDSEVTERIFSHLDVLRI
TTNFQVIKIKALITKRLYDCLKSDSKSMPFLISFCFSTLFMRLTRSLHNDSLISIGFDSK
FHDDWKNCKLPNRFQKLTSFNQIKNAFYLPNKLHCSYRLHLADNTNIPNSQQYILNILLD
LLDKTPLFTPILHVIQLISRYPRGNFEKKSLILKIVSEREFLVLQGFLSERFDKLKSICS
IIHSFFDNFDFVLNEINSRLNHLTDPSFKYYDEIKVINERISNNIVQDQTEMKKSLKHLN
NFDCCQMKRIISHDHFHEEFQEPSNFVQGRRIKLLKEYEIYVYVEDKKLILYYDGKKVKI
DPSDVQAILWRSPMHIQTGVEIYLKTGKRYFIDFSPHKNSVFFNLLKDFKFSKKCIIQNV
PYKEFVKEQDLLHQFQSSQISTFEFLLKLNLFSGRTFSDYKLYPFFPILEMNFDGQYTKR
DFRLPIIAQTPDKQKFFKNQLEDKSEDRFNLGVPMSSPIFVGSFLYRIEPFLSLNKILHE
NKVEDEEFLFTSISNYCNLIKTTNEDREATPEFFTLPEAFKGFENKFNDYIEWVYNNRKV
LNSSGMKLEICNWVDSNFGFAQRGKSAIERYNVFLPFLYEDAWSKISDNETNMAKELMST
LGIVPPQIFTEKINIDQFSTPFSDLEIFRSLSFSQFFSHNNSNNNNINNTNSSNNCNFVT
SEIFFENNIQKIVVLTTDNKLCILTSDLVNKHISIDKTFDVESAKFLTSSYFSFVYLDNS
HTLHFHYKHQNIEIKETEDIKFIDHDYKTITTATLNGIVKVYKSDKLIRRFNVFCDEIVF
IKTSDKFGIVVTATADSFLSIYSIFDGNIINTIHVEGFVKCIDITSEFGFILCATSTHFY
IITVNGTVDKSIRILRDISMICSWISPISFVDCVCTSDSSGSLTIFEAFYPDKVLLTASS
GSCVTSMKYDNNLMGIITLTSSMNLLFFPFY
Download sequence
Identical sequences A2DVS7
5722.A2DVS7 XP_001327713.1.43485 87328.m00133 gi|121910646|gb|EAY15490.1| gi|123499852|ref|XP_001327713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]