SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 89808.m00120 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  89808.m00120
Domain Number 1 Region: 1-243
Classification Level Classification E-value
Superfamily CutC-like 1.96e-72
Family CutC-like 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 89808.m00120
Sequence length 246
Sequence
MKVEVCVDNIESVKIAESAGASRIELCGSLALGGVTPPYSLIKKAVEVSKIPIYVMIRPR
AGDFLFNEEEVEMMINDIKISKELGAKGVVIGALTKSAELDIETTKKLVDAASGIGVTFH
RAFDLVKNPKETLKKLIELGCERVLTSGCAQTAFDGREMIKELVELSEGKISIMAGAGVS
AKNCQEIVKFTNISEIHLSGKTTRESIMDYSCVKAVMGQNPADDGRIGMTSYEIVYNVCS
LLNVNN
Download sequence
Identical sequences A2F3H3
89808.m00120 XP_001313482.1.43485 gi|121895367|gb|EAY00553.1| gi|123449528|ref|XP_001313482.1| 5722.A2F3H3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]