SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 92406.m00159 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  92406.m00159
Domain Number 1 Region: 1838-2136
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-111
Family BEACH domain 0.000000433
Further Details:      
 
Domain Number 2 Region: 2255-2446
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000151
Family WD40-repeat 0.014
Further Details:      
 
Domain Number 3 Region: 1745-1820
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000307
Family PreBEACH PH-like domain 0.035
Further Details:      
 
Domain Number 4 Region: 812-951
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000813
Family Clostridium neurotoxins, the second last domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 92406.m00159
Sequence length 2460
Sequence
MILDIDTVQNKTFLEIIERCPTTKYQSFSEDAGYINEINDYPLSPIPPATIRQIKAQIEQ
GIKFHIPYYDLNIEFSPPQELIQNILSQPTVTERIRSYHSSYLVHYLMTWIIHCKVEKKF
ENFKQLIPIFYFNYSSDYTAIYLNTFFVYIKLLTEPNIPAKEFDDLYSLISDIFLEYSSL
PGYALKLLPDILKSSIGIVENEFPPEAIKFTTLITILLQKFSKDFDPSIISEIYETVYPY
LSQLDFVVLSFFGDIVQYLERKISINFISSLALLFWAKICDNDPYVPVPTKSEIQIPYET
GEFSIPNELDWNKPVFEFPSADKSRLSPPYMSNYIPILEKITGSEQDYYTAVVGNLIALI
SKNSDNVRVWDLIFIFIRYLLIVYDHSEQFPDPLFFIFKSFVFSSDYNALDPKPGYENIS
LCRTFLVRLLLNTDSSAFQTVLNSFLENIPILTELFERFILEIKQIRILMSKDKKLFLYF
ATISNTIFKLKSDLPKIAFLRFINELFKETLMIRFAFAYSEFSTFFVNLLNHKSTRDNVF
QIVKHYVSKQTSIEFITSLRTFFSKKCQEFPDNFSYSIVKDFIEFVIQDQAILKNLSAFV
DVVLQYFILGLSKNEKMISIDDVNRYVVEISMVSEPSDELMLIYQHMLEKSTLDTVLFEK
LQKLIFDQKDQEQNIVKYPLIFKMLVNIFYPLFTDDVLDYISSLLNYSDLNCVAAHRADI
NLYLTEKLLDERNGKSLDEKLVDKILSLLYKIGCVISSPIIVNKFISLFCAENGVLSKYY
DKYLAVLSDFLKSNLEIPEEKLPLEPMFAIEFRTYGNFNPNDGFTFTTWIYLDIPSITRL
FEILEEKNSLFAIVVKQNTLVYDGNVILDNLPLKKWFFLALTYKQNQIEIFFDGNIEKVV
DATINFPSIKNFVLKIGGSQSKCGDIGAHGLFNTLSLSQIKSIYQLGPRNNYSTEITNIF
YKNSTDILELCSQTAKTVSQLNFAETIIRICKLDVLLPLFAQLDIKDNNGFVSDRLPMVL
NLVKSIITSNSEQEIAFHYNDGFQVISHLLLSSKYSGFNFETYSQFYNVFLELSYEDLRI
DILESFLLNFELWMSGDPCHFLKITSHWKSTLFPIAGPTIIHFLSCSTLLNYMRIYCWYL
PLETHQIRGDMERKSDRKIITSIRHNIMNIISENYMGSLTINDFKLLLSQCMSCIDPNQV
YDLLLLLNKFATLSSTAKEFFDTPASFCGLHSLLLSSDEFVSTATLDMIMQIHKNNLITS
CSLTEHLELIFHNLKKGYLTQGMLMKISIITQPSAPELFNLCCYIANRVGAEENMRMLLE
RLEPDPDFAIPKNWCVWAVVAAINTNEILMKMIFEFLALCTPSQWLTIYTVIEHVCRAFQ
KQNEDIKAIFLETILSLSLFGRVKLKQNDLEMLYMMVSTFLFFRDSQTHNPVLIELLKKE
GIEVPKVTQILPQMRDVSTVSGWDYFTENDLWLYNKDIKKEDQEVDIEKIVYDTKVLSLQ
FSIGLRISIDCDWIDHSIASKLLRIQMQTKLMNFMDFCFLVCGFLMRTNHPQKEFVETFK
DANSIYKDFAFGRLCCIEIKNSLFYHEVCDNTARLLDALRMNAAESYKKGLEIFKMKPQD
LEDFSSNSLMETQEAIKEEMENGAKEWRIKWSHMTIENAPWDTKSKSNVVKHYKQSFILC
TNNTQVVLKRNKHFDLHKIASELRDSGAVFENLPKQKPKVRILHPLDIVEYEKTEHKENN
SQFYVIFSTECELVTVKGDKTGNFELLEDLLRIRIENKSSILIKISDIEKILLRRKIHRP
TAIEIFTYNGQTFFVNFTNFTGLVILKELKRHYPSLGNKVQSTDNFMEFFKGFDFSEKWA
NGEISNFEYLMLLNIYSGRSYNDSSQYPFLPWVIKDYTSEKIDISDSKYYRDLKKPIGAI
GKDRLNDLKSRVKDLLQFGISPFLYSSYYTSPLSLYLYLMRMEPFTTLHIEIQSGRFDNA
ARLFLSVSGAFKSVITQMNDYRELIPEFYCMPEFLMNLDQFDLGKTDGQRVNDVILPPWS
KNAMDFVYKMRKFLESDVVSSTLNDWIDLVWGYKQRGENAEKCDNVFKQEMYDTIWSKEQ
QQKSETMPMRINEIESMINLVGQIPPQLFNEPHLKRVTNKRNVSCLARFIQKNLVLYPAS
FSSIEEIERGKISLDVLAANMITKVNILITDNAEPQFEFIPNSAKGFIPLDICEVVNLGG
KLHCGIGNSNYDVIAFLINTGACEIMPRPRQLVSSISASGGFLAIASEDARIHIYKRNNL
KTEVASIPSYRSSIKSVCISTDFHTVICGTSDNALLFTSLATYETYRVVEIDISPRHIIV
TSGWGFVVVYGDLINDGIRQHFIDAYNINGQQIRHFSVDFDVVCWSSFKSPRGFDFIVAG
TSDGRVFIFEAYFGRIGFPVIDAGEEAICVQYLPQSNVVICITRNKITIAPYIIEENKLD
Download sequence
Identical sequences A2EMN1
gi|121901080|gb|EAY06101.1| gi|123470234|ref|XP_001318324.1| XP_001318324.1.43485 5722.A2EMN1 92406.m00159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]