SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 93865.m00246 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  93865.m00246
Domain Number 1 Region: 716-797
Classification Level Classification E-value
Superfamily E set domains 0.00000000658
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 93865.m00246
Sequence length 870
Sequence
MFFLLVLSSLSENIDNGKGIYKSVQKGDEKKDATFKNPDKNVSINLGNVKAQNSLQNVKN
ISQINDNATDSDEIDLELLNREIVRKERREREQKLKEMNLNATNNTNTHDSKPENSSIEF
EIPSNEKTTNKTVKNENTMMNKNESLQQNENSTEIKLNVEINNGNATEIVKSNHTEKQES
DNKLHLNEKDQEKENEINKEISDIIDDNNHNATAENNENDLKNDPVKLKNETNFESEIIK
SLLNETIPDQQNETVANLTKANSTKLAKNKIDIANFRPLEIIQDDEVMNETIQHDNMTKK
EEIQINKNNETISGKKPEEHLKNDVKVNETEISKSSGAEYMKNTTNTEIKQENTIKIEEI
VSETNITNENITENATTTKIENKLNISEENSTKIKSEKSQTIEETNSTKAVPEKSEINVS
QIQTQNESITTIDEYADNGNITVKDKLNEKPKDKIIKSQNETKIEETNNETMIKEENNTI
VQESKVISEVKENISENQPQKQSDAQNTEKTDVTEEGTSNVTHSEEKIQENPNITISEVE
KEPDTQENIKSNITEPEKSLIDHSEEKNSDNKNISESKVEKQSETQEKEKADEIKVEKSI
VDHSKETISENKNSSVSKAENKSSESQISISNVYDDDIIDSISSSPTDIPAPKEVNLGES
SVVDSTSTTHSKQVSTDNECTQPCHQNAECIRGKCECKEGYTGDGIKVCTDEIPDVVSLD
PSSGDSSGGAEIQITLSKIITTKHSVFVRFGSSIVRAQSAVQKVVTVVVPPHEAGEVPVA
ISYDQKSWSSKTKLFKYTQEGNNGKFGLSFNVVIIVVIVVAAAIGAAVSKFKSGKKKSKP
VISINSQYDDKETEDFERQPLLPKKRSHQD
Download sequence
Identical sequences A2DWQ6
gi|121910239|gb|EAY15088.1| gi|123498064|ref|XP_001327311.1| 5722.A2DWQ6 XP_001327311.1.43485 93865.m00246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]