SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 97483.m00097 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  97483.m00097
Domain Number 1 Region: 385-622
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000118
Family Tropomyosin 0.0029
Further Details:      
 
Domain Number 2 Region: 223-390
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000124
Family Tropomyosin 0.0038
Further Details:      
 
Weak hits

Sequence:  97483.m00097
Domain Number - Region: 88-216
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0288
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number - Region: 628-833
Classification Level Classification E-value
Superfamily Tropomyosin 0.0763
Family Tropomyosin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 97483.m00097
Sequence length 871
Sequence
MSDKSSSITDAQQHLAEFSQTTFTDLQHDFHELNHEIPQDSPLETYRHEYAKLFGILQKS
MTNQARYIEKCRVLESEITGNNSKVKTVSKLAEEDSKSIANLNDDRDKKQNALNQSKESL
RAAMEQNQIVSSRITELENKLEECVAAERSKKDYLKQLKNRRSELKKEHDELTQQIPQYQ
ENNKQTSEKLEQKDREIEETLNDLKRIEDMVAAKRLEEQKERQTLMMLERDRDATRVRLQ
EARQKTKDRSAEVQAKQEESRNLTKKVQDLKRRFESAKVEKQDMADKCTKLQKDLESLQG
IITSLEKEISDSREILNQKQKETDQLQQVCQKKEQERENVEIRKQALQDQFGALRKEADA
VKIDINNSQAQLDELRRKCEFTRKQIDTANREENSKIKKDQTEKQKLSKAETVLQMYKNQ
SSNIECEIAIIKSHLQETQKKIFSIEKDRERYSEELSQATSQYLHAQDILKDIDNKVQMK
NKEIVEADKKVRQQQTLYEQVRSERESASKKVKDVRAEIEQLDHEFTRMKNAIDQHKDDI
RRKEAEKIKDKKSLNDVIEKDQKLRAQLTAIQIKTTTSQRSISSHEGEISKLEKAIKDAE
IQLGIEQKKLADVKKERDYMSNENVKRELEIKEVGQKLDILRNQLRRGEKDFNLKEQDVS
RIRRQIQDSQDQLTNLSQFDIQLKEKRDEIHFLQKELLQLKAERAAMEEELKIPINIHRW
TLLESSDPQRFEALKRYQELQATLVEKTKQVADLQDKIKEEESRYTELCAQVRRKPGVEV
QQTVDEYKQSTKSEAYSLEKLTQRLEMARDDVKEFRKELGEAEQELLQQRNKWIAQKKKD
IKRRRELQEQEAMCKELGISSLSTNLDQFNL
Download sequence
Identical sequences A2EIM9
97483.m00097 XP_001319679.1.43485 gi|121902468|gb|EAY07456.1| gi|123472977|ref|XP_001319679.1| 5722.A2EIM9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]