SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Cocmi1|9086|gm1.9086_g from Cochliobolus miyabeanus ATCC 44560 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocmi1|9086|gm1.9086_g
Domain Number 1 Region: 82-299
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-44
Family C-terminal domain of adrenodoxin reductase-like 0.00000785
Further Details:      
 
Domain Number 2 Region: 9-138,318-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000012
Family C-terminal domain of adrenodoxin reductase-like 0.0016
Further Details:      
 
Weak hits

Sequence:  jgi|Cocmi1|9086|gm1.9086_g
Domain Number - Region: 340-448
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00124
Family N-terminal domain of adrenodoxin reductase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocmi1|9086|gm1.9086_g
Sequence length 453
Sequence
MNKNQDAVIDMYEQLPVPYGLVRYGVAPDHPEVKNCQDTFEEVARSPRFNYIGNVKVGYD
MQLADMKPHYDAILFSYGATEDRQLGIPGENLPGVYSARSFVGWYNGLPQFQHLEPNLHA
GEQAVVIGQGNVALDVARILLSPVDALRSTDIADQAIQALSESKVRSVRVVGRRGPIQAA
FTVKEARELMQIPSVAFEPIDRSLYPADIKKLPRVQKRIAEVLLKGSATPAQQATRSWAL
DFLQAPKAMHEVDGHLSSITFTKQQFVPDGDPFDQRTRVVSTKDETSIEASLAFRSVGYK
SAALPGLSAIGVPFDNKLGIIPNDMHGRVITPSAGPGNLTAGHVSGLYCAGWVKRGPTGV
IASTMQDAFSSADIIAQDWEAGVPFLNDINDENEGTKLGWEALRAAVESKGVRPLSWADW
KRIDDAERENGKAKGKQREKFQSVEEMLSVLDA
Download sequence
Identical sequences W6YP17
jgi|Cocmi1|9086|gm1.9086_g XP_007692319.1.18027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]