SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Cocmi1|108403|e_gw1.235.37.1 from Cochliobolus miyabeanus ATCC 44560 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocmi1|108403|e_gw1.235.37.1
Domain Number 1 Region: 24-76
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000316
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 93-130
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000534
Family Zn2/Cys6 DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocmi1|108403|e_gw1.235.37.1
Sequence length 899
Sequence
MMQVSTAQPNTQPAHAELDAEQARLFQCSTCKRSFTRADHLTRHVRAHTKSKPYICPVCS
KGFARIDLLKRHVANHDTEPANKRQRREISRDTRVVQACEACSQSHLRCEDEKPCSRCKK
KKIPCKVPESLATDENESHEIDAVHAAQDLLDLSNGFDYPSSLPGQSGNANPPASTTSQT
PESFHNSQHLSMVDSNSTKTDSAGCRSSDTSTSVMNTMQPPPNTGNGLVTMNHNFEEPDP
TSAMSFFDSSIPPFDNTPAQNPFLPDYFRNMPPFDAFLSGQATPRGILDLSFDIDVGLTD
LDLGLLDQYNFQAPFAADTPSTDAHGTEHSHPETDTAPGRAEAFKQSIWRYLPQSSRNPS
AEQVNLAFSDAERDSRRAHIAQRRVVAEKLPRVSRDRLMVLVLGTCTPENVKKIASAFPS
VELLDGLIQYFLTSPSLDALTWFHLPTFSPSKLNPELLASIASAGAATIPDSSLRKLGYA
LHEASRMGQSRSFEEDNTAIRDLQHLQTFLLQLGVGMWSGISRKMEIAESFTQPLITMLR
RGARFRRSTWKEIRPEPDEQGSALETKWFNWVQQESFLRLVYRAFEFDRQSSMALLKPPL
VSYAEMQLPLPSSNALWQAKSATSWKAAYLNLPPMAVNKPSAIECFLNLGHLSHHDHASL
TYLYMIWGAIWEYRQMCTVTSRSQAVSNNSLILSSRYQDLTKQLDDFRLSCPPMNKSVEM
TLEIMLVHLNAPLDDIQLFAGIEGQEEARIAYVGLRDWTNTPSARQALWHAGQVLRAAEV
LPKALLNNFNAIAVYHAGLILWCYGFLKRSIAPESTQIDTMVVLNGDDSLSARKFITLDR
GIPSIRTYGSHSPTQLNDVCGVMDSLVHLLRTRHDASEPCPPLVGNLVQLLEGLRSAIK
Download sequence
Identical sequences W6YSS8
XP_007692896.1.18027 jgi|Cocmi1|108403|e_gw1.235.37.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]