SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Cocmi1|1594|gm1.1594_g from Cochliobolus miyabeanus ATCC 44560 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocmi1|1594|gm1.1594_g
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000289
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 2 Region: 71-112
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000366
Family Zn2/Cys6 DNA-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocmi1|1594|gm1.1594_g
Sequence length 1012
Sequence
MVFCTYCGQSFTRDEHLERHILTHTNVKPFKCFTCHMSFARRDLLQRHYTVHGRNQNNEE
GLPPQGIIPKSAGRTPIACSNCAKTKTKCDKKFPCTRCAQRNLKCTLRPTRRASKGVQRV
GGPAEATSGDSSESGSTTENQNNSGNTSPNHESQSQPQSQQPTAQSSPAQIHQQPQLSNG
QPSSQRQSQSPSASHSRNPSISQSVQAPSHISPEEKTLHLPLTNTPPFFDQSPSHALSQA
PSLLSPLPTPVTGMNSFVSSTPMSGYDDFVRTVRDQGDNESPQFMMDPWHNMPMDTGFDP
MRLDPSLMMSMGMDMSMGPPPEGILGMIPEMSPAQTFAHAPTPRVDESFSDLQIGSSAAM
FYPSNRQSSIADAGVPDLGAIIAAQDGWTVFRCTPSIASSSCPRTARLNLERLELSLKNH
EAWSSWTPSWDESDFQQGGRIAVSKLQESTRDKLLAITQSFLHKALDIHKEGSSTTSSGE
SPGSTASHSNFVLLPPARVLEYFLKSYANSFERYYPTSARGVLDTNELMQNYNDKASSLL
ILMMIAQGAMTIPSIEARWLTGGFTEACRISLFDLIEKNIIMAGDPIVLRAALLFTVQAA
WSGDKWQMDIAMGQRGMYFSMLRHSGILDVRPPSTPHMNGTSTTDSLWKDWLQQESRSRL
IYSWVMVDQDLSLFHDTAPLFSVTEFGASMPDSDRLWQAQTASEWSDMFNQVHEFSNGYS
SVGSGARPPSLRDLFRYFLDDEIVVQDVQEIHLTPMHLRLLLHPLQTLVCQYCQLLSCFS
DSVASRSRNRALTAASTRVRLEEVQALLGRWFDLAQRYMKANPICPMMQANLVMFHLISM
NAVSNFPEIERLARREGIDGSYQQMVWMHKKCLSDVQEAITHAGQVLRLIRDMPRGIRPP
WWAGAVYRAALIVWTDSLNQKESLSPNQQNAYQQQPPNAAFSVDRLPADHPTILRYMSRR
DGIPTLTKRDGTPVPLDNGFAVLSHCVDVIDEGVATRFSDGIRSKLQKLARG
Download sequence
Identical sequences W6ZIJ2
jgi|Cocmi1|1594|gm1.1594_g XP_007683728.1.18027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]