SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000201 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000201
Domain Number 1 Region: 338-452
Classification Level Classification E-value
Superfamily Integrin domains 1.83e-19
Family Integrin domains 0.001
Further Details:      
 
Domain Number 2 Region: 621-698
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.97e-17
Family Integrin beta tail domain 0.0027
Further Details:      
 
Domain Number 3 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000018
Family Integrin beta EGF-like domains 0.0019
Further Details:      
 
Domain Number 4 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 5 Region: 23-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000235
Family Plexin repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000000201
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family Integrin beta EGF-like domains 0.03
Further Details:      
 
Domain Number - Region: 500-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000201   Gene: ENSTBEG00000000245   Transcript: ENSTBET00000000237
Sequence length 768
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3624:95076:227675:-1 gene:ENSTBEG00000000245 transcript:ENSTBET00000000237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDQCPLLLALVGLLSLGPALPQECTKYKVSTCRDCVESGPGCAWCQKLXXXXXXXXXXX
XXXXXXXLLMKGCAADDIMDPRSFAETQVDRAQRQKQLSPQKVTLYLRPXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD
YPSVGQLAHKLAESNIQPIFAVTKRMVKTYEKLTEIIPKSAVGELSEDSSNMVQLIKNAY
NKLSSRVFLDHNTLPDNLKVTYDSFCSNRVSLMNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFTIRPLGFTDTVTVRVLPQCECQCRDQSQDRSLCSGKGSLECGICRCDAGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCICGQCVCHASDVPNKQIFGQYCECDNVN
CERYDGQVCGGEKRGRCSCGKCYCAEGYDGSACQCQKSTEGCLNQRRVECSGRGRCLCNV
CECEDGYQPPLCQECPGCPSPCGRYVSCAECLKFDKGPFGKNCSAQCRNLHLMDSPTRGK
TCKEQDSEGCWVTYTLRQLDGRNRYEVHVDENQECVEGNIAAIVRGTVAGVVLIGVLLLV
IWKALTHLNDLREYKRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Download sequence
Identical sequences ENSTBEP00000000201 ENSTBEP00000000201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]