SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000324 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000324
Domain Number 1 Region: 262-425
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.26e-49
Family Eukaryotic ODC-like 0.000000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000324   Gene: ENSTBEG00000000376   Transcript: ENSTBET00000000376
Sequence length 461
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1569:6813:10832:-1 gene:ENSTBEG00000000376 transcript:ENSTBET00000000376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSFNNEEFDCHFLDEGFTAKDILDQKINEVSCSXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXITSVINPALDKYFPSDSGVRIIAEPRRYYVASAFTLAVNIIAKKIVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYPSSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPMWQLMQQI
QNHDLPPGVEEQDVGTLPVSCARESGMKRHPAPCASASINV
Download sequence
Identical sequences ENSTBEP00000000324 ENSTBEP00000000324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]