SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000331 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000331
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.56e-43
Family Papain-like 0.000000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000331   Gene: ENSTBEG00000000390   Transcript: ENSTBET00000000384
Sequence length 168
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_863:37666:42438:-1 gene:ENSTBEG00000000390 transcript:ENSTBET00000000384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RINIKRKGAWPSTLLSVQHVLDCGDAGSCEGGNDLPVWEYAHRHGIPDETCNNYQARDQD
DSLSGREMMAEIQTGPISCGIMATEKMERYGGGIYAEYYDQAYINHIVSVAGWGVSEGTE
YWIVRNSWGEPWGERGWMRIVTSTYKNGTGASYNLAIEESCTFGDPIL
Download sequence
Identical sequences ENSTBEP00000000331 ENSTBEP00000000331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]