SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000452 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000000452
Domain Number - Region: 270-327
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0251
Family N-terminal domain of MutM-like DNA repair proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000452   Gene: ENSTBEG00000000535   Transcript: ENSTBET00000000521
Sequence length 399
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5438:292476:303256:-1 gene:ENSTBEG00000000535 transcript:ENSTBET00000000521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGHTKTPSATLLSSVPSCRSLSPSEDSPSCHCNLSSEELAQNLQESIRHWILHLAEQLRV
EEASRDENTVGYLKLVSNADRHQAPHIRQAFEKVNQHTSATTAHIERRLRQCHQQLQELE
EGCRPKAMVLIAGSIFIICQQPNEKISFSVSPQLSRGAHQPSLLESSPAGLQQGRPSETK
PATQPPHLLLLKVKKELEDIQKTPFHLQVSYQSLKDRYLMDLQVSLESLQEQKCRQTVVE
EQVNEHLQGHLDEIYHLKQNLACTEEKMAYLSCKRAKEIWEVMESFQSRIAKLEVLQQIA
QLQMTGCLRSRPQYVLYKHTSLFFMLATVLLASLYRMCAYLSRQNNSRLRTGTVLLLLGL
MALAWQKWHAIATADWQAWVLYRWRLYSKDSRAPSDGPC
Download sequence
Identical sequences ENSTBEP00000000452 ENSTBEP00000000452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]