SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000525 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000525
Domain Number 1 Region: 44-276
Classification Level Classification E-value
Superfamily PLP-binding barrel 9e-41
Family Alanine racemase-like, N-terminal domain 0.000000828
Further Details:      
 
Domain Number 2 Region: 255-414
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 7.74e-32
Family Eukaryotic ODC-like 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000525   Gene: ENSTBEG00000000599   Transcript: ENSTBET00000000605
Sequence length 446
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5505:77317:97203:-1 gene:ENSTBEG00000000599 transcript:ENSTBET00000000605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSAPAVLEILAALGTGFACSNKNEMALVQELGVTPENIIYISPCKQVSQI
KYAKVGVIMTCDEIEEKIARNHQNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECA
KELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAXXXXXXXXXXXXXXXXXXXXXX
XXXVNHVISPLLDIYFPEGSGIKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSSGVEK
TGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKATKYKDDEPLFTSSLWGPSCDELD
QIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQKPAIYYMMSFSDWYEMQDSGITS
DTMMKNFFFVPSCFQLSQEDSFSTEA
Download sequence
Identical sequences ENSTBEP00000000525 ENSTBEP00000000525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]