SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000723 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000723
Domain Number 1 Region: 30-68
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000484
Family Ribosomal protein L11, C-terminal domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000000723
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.00229
Family Ribosomal L11/L12e N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000723   Gene: ENSTBEG00000000836   Transcript: ENSTBET00000000826
Sequence length 68
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_6038:214816:215120:-1 gene:ENSTBEG00000000836 transcript:ENSTBET00000000826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRCTSGEVGAMSALDPNIGPLGLLIEVVPSALIVKALKESPKDRQKQKDVKHSGNVTFDE
IVNIARQM
Download sequence
Identical sequences ENSTBEP00000000723 ENSTBEP00000000723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]