SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000940 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000000940
Domain Number - Region: 121-166
Classification Level Classification E-value
Superfamily F1 ATPase inhibitor, IF1, C-terminal domain 0.0392
Family F1 ATPase inhibitor, IF1, C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000940   Gene: ENSTBEG00000001096   Transcript: ENSTBET00000001082
Sequence length 170
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2074:495:93300:1 gene:ENSTBEG00000001096 transcript:ENSTBET00000001082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELEV
KTREKLEAAKKNTSFEIAELKERLKASRETINCLKNEIRKLEEDDQTKDI
Download sequence
Identical sequences ENSTBEP00000000940 ENSTBEP00000000940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]