SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000981 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000981
Domain Number 1 Region: 29-66
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000000314
Family FKBP immunophilin/proline isomerase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000981   Gene: ENSTBEG00000001163   Transcript: ENSTBET00000001139
Sequence length 66
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_206:83607:108436:-1 gene:ENSTBEG00000001163 transcript:ENSTBET00000001139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQVETXXXXXXXXXXXXXXXXXXXXXXMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQ
Download sequence
Identical sequences ENSTBEP00000000981 ENSTBEP00000000981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]