SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001096 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001096
Domain Number 1 Region: 428-568,674-688,720-782
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.69e-34
Family Phosphate binding protein-like 0.00028
Further Details:      
 
Domain Number 2 Region: 26-261,308-425
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.22e-28
Family L-arabinose binding protein-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001096   Gene: ENSTBEG00000001221   Transcript: ENSTBET00000001270
Sequence length 1003
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3302:48214:1030969:1 gene:ENSTBEG00000001221 transcript:ENSTBET00000001270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVFPLLLVLSVWWARTWDAANAVIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQTE
KITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQR
STAGTPRSGCGLTRSNRNDDYTLSVRPPVYLNEVILRVVTEYAWQKFIIFYDSEYDIRGI
QEFLDKVSQQGMDVALQKVENTINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKS
FITEVVETNLVAFDCHWIIINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSK
PWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNP
VTGLNGSLTDKKLENNMRGVVLRVVTVLDEPFVMVSENVLGKPKNHQGFSIDVLDALSNY
LGFYEIYVAPDHKYGSPQEDGTHGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDY
SVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPRLQMGSMTSTT
LYNSMWFVYGSFVQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXSLQDLSKQTDIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLE
SQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPYRDVF
SQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTP
LDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFAFGNVPEHRTGP
FRHRAPNGGFFRSPIKTMSSIPYQPTPSLGLNLGNDPDRGTSI
Download sequence
Identical sequences ENSTBEP00000001096 ENSTBEP00000001096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]